Anti BICDL1 pAb (ATL-HPA061116 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA061116-25
  • Immunohistochemistry analysis in human kidney and liver tissues using Anti-CCDC64 antibody. Corresponding CCDC64 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BICD family like cargo adaptor 1
Gene Name: BICDL1
Alternative Gene Name: BICDR-1, CCDC64, FLJ26450
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041609: 97%, ENSRNOG00000056955: 97%
Entrez Gene ID: 92558
Uniprot ID: Q6ZP65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNELKRLIQSIVDGMEPTVT
Gene Sequence LRLQLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNELKRLIQSIVDGMEPTVT
Gene ID - Mouse ENSMUSG00000041609
Gene ID - Rat ENSRNOG00000056955
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti BICDL1 pAb (ATL-HPA061116 w/enhanced validation)
Datasheet Anti BICDL1 pAb (ATL-HPA061116 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BICDL1 pAb (ATL-HPA061116 w/enhanced validation)