Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023013-25

Protein Description: bicaudal D homolog 2 (Drosophila)
Gene Name: BICD2
Alternative Gene Name: KIAA0699
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037933: 100%, ENSRNOG00000016031: 100%
Entrez Gene ID: 23299
Uniprot ID: Q8TD16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAI
• Gene Sequence: MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAI
• Gene ID - Mouse: ENSMUSG00000037933
• Gene ID - Rat: ENSRNOG00000016031
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BICD2 pAb (ATL-HPA023013 w/enhanced validation) – 4 Found

Will, Lena; Portegies, Sybren; van Schelt, Jasper; van Luyk, Merel; Jaarsma, Dick; Hoogenraad, Casper C. Dynein activating adaptor BICD2 controls radial migration of upper-layer cortical neurons in vivo. Acta Neuropathologica Communications. 2019;7(1):162. 

Fellows, Alexander D; Rhymes, Elena R; Gibbs, Katherine L; Greensmith, Linda; Schiavo, Giampietro. IGF1R regulates retrograde axonal transport of signalling endosomes in motor neurons. Embo Reports. 2020;21(3):e49129. 

Agote-Aran, Arantxa; Schmucker, Stephane; Jerabkova, Katerina; Jmel Boyer, Inès; Berto, Alessandro; Pacini, Laura; Ronchi, Paolo; Kleiss, Charlotte; Guerard, Laurent; Schwab, Yannick; Moine, Hervé; Mandel, Jean-Louis; Jacquemont, Sebastien; Bagni, Claudia; Sumara, Izabela. Spatial control of nucleoporin condensation by fragile X-related proteins. The Embo Journal. 2020;39(20):e104467. 

Leong, Ei Leen; Khaing, Nyein Thet; Cadot, Bruno; Hong, Wei Liang; Kozlov, Serguei; Werner, Hendrikje; Wong, Esther Sook Miin; Stewart, Colin L; Burke, Brian; Lee, Yin Loon. Nesprin-1 LINC complexes recruit microtubule cytoskeleton proteins and drive pathology in Lmna-mutant striated muscle. Human Molecular Genetics. 2023;32(2):177-191.