Anti BICD1 pAb (ATL-HPA041309)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041309-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BICD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003452: 94%, ENSRNOG00000036911: 94%
Entrez Gene ID: 636
Uniprot ID: Q96G01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE |
Gene Sequence | YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE |
Gene ID - Mouse | ENSMUSG00000003452 |
Gene ID - Rat | ENSRNOG00000036911 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BICD1 pAb (ATL-HPA041309) | |
Datasheet | Anti BICD1 pAb (ATL-HPA041309) Datasheet (External Link) |
Vendor Page | Anti BICD1 pAb (ATL-HPA041309) at Atlas Antibodies |
Documents & Links for Anti BICD1 pAb (ATL-HPA041309) | |
Datasheet | Anti BICD1 pAb (ATL-HPA041309) Datasheet (External Link) |
Vendor Page | Anti BICD1 pAb (ATL-HPA041309) |
Citations for Anti BICD1 pAb (ATL-HPA041309) – 3 Found |
Terenzio, Marco; Golding, Matthew; Russell, Matthew R G; Wicher, Krzysztof B; Rosewell, Ian; Spencer-Dene, Bradley; Ish-Horowicz, David; Schiavo, Giampietro. Bicaudal-D1 regulates the intracellular sorting and signalling of neurotrophin receptors. The Embo Journal. 2014;33(14):1582-98. PubMed |
Fellows, Alexander D; Rhymes, Elena R; Gibbs, Katherine L; Greensmith, Linda; Schiavo, Giampietro. IGF1R regulates retrograde axonal transport of signalling endosomes in motor neurons. Embo Reports. 2020;21(3):e49129. PubMed |
Budzinska, Marta I; Villarroel-Campos, David; Golding, Matthew; Weston, Anne; Collinson, Lucy; Snijders, Ambrosius P; Schiavo, Giampietro. PTPN23 binds the dynein adaptor BICD1 and is required for endocytic sorting of neurotrophin receptors. Journal Of Cell Science. 2020;133(6) PubMed |