Anti BICD1 pAb (ATL-HPA041309)

Atlas Antibodies

Catalog No.:
ATL-HPA041309-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: bicaudal D homolog 1 (Drosophila)
Gene Name: BICD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003452: 94%, ENSRNOG00000036911: 94%
Entrez Gene ID: 636
Uniprot ID: Q96G01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE
Gene Sequence YRQSRVTRSGSLKGPDDPRGLLSPRLARRGVSSPVETRTSSEPVAKESTEASKEPSPTKTPTISPVITAPPSSPVLDTSDIRKE
Gene ID - Mouse ENSMUSG00000003452
Gene ID - Rat ENSRNOG00000036911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BICD1 pAb (ATL-HPA041309)
Datasheet Anti BICD1 pAb (ATL-HPA041309) Datasheet (External Link)
Vendor Page Anti BICD1 pAb (ATL-HPA041309) at Atlas Antibodies

Documents & Links for Anti BICD1 pAb (ATL-HPA041309)
Datasheet Anti BICD1 pAb (ATL-HPA041309) Datasheet (External Link)
Vendor Page Anti BICD1 pAb (ATL-HPA041309)
Citations for Anti BICD1 pAb (ATL-HPA041309) – 3 Found
Terenzio, Marco; Golding, Matthew; Russell, Matthew R G; Wicher, Krzysztof B; Rosewell, Ian; Spencer-Dene, Bradley; Ish-Horowicz, David; Schiavo, Giampietro. Bicaudal-D1 regulates the intracellular sorting and signalling of neurotrophin receptors. The Embo Journal. 2014;33(14):1582-98.  PubMed
Fellows, Alexander D; Rhymes, Elena R; Gibbs, Katherine L; Greensmith, Linda; Schiavo, Giampietro. IGF1R regulates retrograde axonal transport of signalling endosomes in motor neurons. Embo Reports. 2020;21(3):e49129.  PubMed
Budzinska, Marta I; Villarroel-Campos, David; Golding, Matthew; Weston, Anne; Collinson, Lucy; Snijders, Ambrosius P; Schiavo, Giampietro. PTPN23 binds the dynein adaptor BICD1 and is required for endocytic sorting of neurotrophin receptors. Journal Of Cell Science. 2020;133(6)  PubMed