Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044573-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: betaine--homocysteine S-methyltransferase 2
Gene Name: BHMT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042118: 83%, ENSRNOG00000040120: 81%
Entrez Gene ID: 23743
Uniprot ID: Q9H2M3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEA
Gene Sequence FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEA
Gene ID - Mouse ENSMUSG00000042118
Gene ID - Rat ENSRNOG00000040120
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation)
Datasheet Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation)
Datasheet Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation)