Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044573-25
  • Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-BHMT2 antibody. Corresponding BHMT2 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: betaine--homocysteine S-methyltransferase 2
Gene Name: BHMT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042118: 83%, ENSRNOG00000040120: 81%
Entrez Gene ID: 23743
Uniprot ID: Q9H2M3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEA
Gene Sequence FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEA
Gene ID - Mouse ENSMUSG00000042118
Gene ID - Rat ENSRNOG00000040120
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation)
Datasheet Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation)
Datasheet Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BHMT2 pAb (ATL-HPA044573 w/enhanced validation)