Anti BHMT pAb (ATL-HPA058310 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA058310-25

Protein Description: betaine--homocysteine S-methyltransferase
Gene Name: BHMT
Alternative Gene Name: BHMT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069324: 90%, ENSRNOG00000011200: 90%
Entrez Gene ID: 635
Uniprot ID: Q93088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFE
• Gene Sequence: KEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFE
• Gene ID - Mouse: ENSMUSG00000069324
• Gene ID - Rat: ENSRNOG00000011200
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.