Anti BHMT pAb (ATL-HPA058310 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA058310-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: betaine--homocysteine S-methyltransferase
Gene Name: BHMT
Alternative Gene Name: BHMT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069324: 90%, ENSRNOG00000011200: 90%
Entrez Gene ID: 635
Uniprot ID: Q93088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFE
Gene Sequence KEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFE
Gene ID - Mouse ENSMUSG00000069324
Gene ID - Rat ENSRNOG00000011200
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BHMT pAb (ATL-HPA058310 w/enhanced validation)
Datasheet Anti BHMT pAb (ATL-HPA058310 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BHMT pAb (ATL-HPA058310 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BHMT pAb (ATL-HPA058310 w/enhanced validation)
Datasheet Anti BHMT pAb (ATL-HPA058310 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BHMT pAb (ATL-HPA058310 w/enhanced validation)