Anti BHMG1 pAb (ATL-HPA049521)

Atlas Antibodies

SKU: ATL-HPA049521-25

• 

Protein Description: basic helix-loop-helix and HMG box domain containing 1
Gene Name: BHMG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048038: 29%, ENSRNOG00000014093: 24%
Entrez Gene ID: 388553
Uniprot ID: C9JSJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDSCGHPRPASSSPPGDRKGGQSQLTLLDLAEDTIHCDISSCWCQGSVQDDAPFPALLAQEDVARIHFLNKTQPHPRQKLVFYDSSEDVDKGSLDADP
• Gene Sequence: PDSCGHPRPASSSPPGDRKGGQSQLTLLDLAEDTIHCDISSCWCQGSVQDDAPFPALLAQEDVARIHFLNKTQPHPRQKLVFYDSSEDVDKGSLDADP
• Gene ID - Mouse: ENSMUSG00000048038
• Gene ID - Rat: ENSRNOG00000014093
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.