Anti BHLHE23 pAb (ATL-HPA030575)

Atlas Antibodies

Catalog No.:
ATL-HPA030575-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: basic helix-loop-helix family, member e23
Gene Name: BHLHE23
Alternative Gene Name: bA305P22.3, Beta4, BHLHB4, bHLHe23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045493: 86%, ENSRNOG00000010312: 86%
Entrez Gene ID: 128408
Uniprot ID: Q8NDY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP
Gene Sequence RLVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCPDKCAAFSGTPSALCKHCHEKP
Gene ID - Mouse ENSMUSG00000045493
Gene ID - Rat ENSRNOG00000010312
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BHLHE23 pAb (ATL-HPA030575)
Datasheet Anti BHLHE23 pAb (ATL-HPA030575) Datasheet (External Link)
Vendor Page Anti BHLHE23 pAb (ATL-HPA030575) at Atlas Antibodies

Documents & Links for Anti BHLHE23 pAb (ATL-HPA030575)
Datasheet Anti BHLHE23 pAb (ATL-HPA030575) Datasheet (External Link)
Vendor Page Anti BHLHE23 pAb (ATL-HPA030575)