Anti BGN pAb (ATL-HPA003157 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003157-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: BGN
Alternative Gene Name: DSPG1, SLRR1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031375: 94%, ENSRNOG00000055962: 93%
Entrez Gene ID: 633
Uniprot ID: P21810
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL |
| Gene Sequence | RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL |
| Gene ID - Mouse | ENSMUSG00000031375 |
| Gene ID - Rat | ENSRNOG00000055962 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BGN pAb (ATL-HPA003157 w/enhanced validation) | |
| Datasheet | Anti BGN pAb (ATL-HPA003157 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BGN pAb (ATL-HPA003157 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BGN pAb (ATL-HPA003157 w/enhanced validation) | |
| Datasheet | Anti BGN pAb (ATL-HPA003157 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BGN pAb (ATL-HPA003157 w/enhanced validation) |
| Citations for Anti BGN pAb (ATL-HPA003157 w/enhanced validation) – 7 Found |
| Müller, Catharina; Andersson-Sjöland, Annika; Schultz, Hans Henrik; Eriksson, Leif T; Andersen, Claus B; Iversen, Martin; Westergren-Thorsson, Gunilla. Early extracellular matrix changes are associated with later development of bronchiolitis obliterans syndrome after lung transplantation. Bmj Open Respiratory Research. 4(1):e000177. PubMed |
| Jacobsen, Frank; Kraft, Juliane; Schroeder, Cornelia; Hube-Magg, Claudia; Kluth, Martina; Lang, Dagmar S; Simon, Ronald; Sauter, Guido; Izbicki, Jakob R; Clauditz, Till S; Luebke, Andreas M; Hinsch, Andrea; Wilczak, Waldemar; Wittmer, Corinna; Büscheck, Franziska; Höflmayer, Doris; Minner, Sarah; Tsourlakis, Maria Christina; Huland, Hartwig; Graefen, Markus; Budäus, Lars; Thederan, Imke; Salomon, Georg; Schlomm, Thorsten; Melling, Nathaniel. Up-regulation of Biglycan is Associated with Poor Prognosis and PTEN Deletion in Patients with Prostate Cancer. Neoplasia (New York, N.y.). 2017;19(9):707-715. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Nisenblat, Vicki; Bossuyt, Patrick M M; Shaikh, Rabia; Farquhar, Cindy; Jordan, Vanessa; Scheffers, Carola S; Mol, Ben Willem J; Johnson, Neil; Hull, M Louise. Blood biomarkers for the non-invasive diagnosis of endometriosis. The Cochrane Database Of Systematic Reviews. 2016;2016(5):CD012179. PubMed |
| Mayer, C; Adam, M; Glashauser, L; Dietrich, K; Schwarzer, J U; Köhn, F-M; Strauss, L; Welter, H; Poutanen, M; Mayerhofer, A. Sterile inflammation as a factor in human male infertility: Involvement of Toll like receptor 2, biglycan and peritubular cells. Scientific Reports. 2016;6( 27849015):37128. PubMed |
| Fujimoto, Noriki; He, Yuliang; D'Addio, Marco; Tacconi, Carlotta; Detmar, Michael; Dieterich, Lothar C. Single-cell mapping reveals new markers and functions of lymphatic endothelial cells in lymph nodes. Plos Biology. 2020;18(4):e3000704. PubMed |
| Greulich, Benjamin M; Plotnik, Joshua P; Jerde, Travis J; Hollenhorst, Peter C. Toll-like receptor 4 signaling activates ERG function in prostate cancer and provides a therapeutic target. Nar Cancer. 2021;3(1):zcaa046. PubMed |