Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA062959-25

Protein Description: beaded filament structural protein 2, phakinin
Gene Name: BFSP2
Alternative Gene Name: CP47, CP49, LIFL-L, phakinin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032556: 91%, ENSRNOG00000010899: 89%
Entrez Gene ID: 8419
Uniprot ID: Q13515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL
• Gene Sequence: YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL
• Gene ID - Mouse: ENSMUSG00000032556
• Gene ID - Rat: ENSRNOG00000010899
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.