Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA062959-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: beaded filament structural protein 2, phakinin
Gene Name: BFSP2
Alternative Gene Name: CP47, CP49, LIFL-L, phakinin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032556: 91%, ENSRNOG00000010899: 89%
Entrez Gene ID: 8419
Uniprot ID: Q13515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL
Gene Sequence YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL
Gene ID - Mouse ENSMUSG00000032556
Gene ID - Rat ENSRNOG00000010899
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation)
Datasheet Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation)
Datasheet Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation)