Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062959-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BFSP2
Alternative Gene Name: CP47, CP49, LIFL-L, phakinin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032556: 91%, ENSRNOG00000010899: 89%
Entrez Gene ID: 8419
Uniprot ID: Q13515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL |
Gene Sequence | YVGTAPSGCIGGLGARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQL |
Gene ID - Mouse | ENSMUSG00000032556 |
Gene ID - Rat | ENSRNOG00000010899 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) | |
Datasheet | Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) | |
Datasheet | Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BFSP2 pAb (ATL-HPA062959 w/enhanced validation) |