Anti BEX4 pAb (ATL-HPA045105)

Atlas Antibodies

Catalog No.: ATL-HPA045105-25

Protein Description: brain expressed, X-linked 4
Gene Name: BEX4
Alternative Gene Name: BEXL1, FLJ10097
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047844: 70%, ENSRNOG00000060103: 72%
Entrez Gene ID: 56271
Uniprot ID: Q9NWD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF
• Gene Sequence: WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF
• Gene ID - Mouse: ENSMUSG00000047844
• Gene ID - Rat: ENSRNOG00000060103
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.