Anti BEX4 pAb (ATL-HPA045105)

Atlas Antibodies

Catalog No.:
ATL-HPA045105-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: brain expressed, X-linked 4
Gene Name: BEX4
Alternative Gene Name: BEXL1, FLJ10097
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047844: 70%, ENSRNOG00000060103: 72%
Entrez Gene ID: 56271
Uniprot ID: Q9NWD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF
Gene Sequence WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF
Gene ID - Mouse ENSMUSG00000047844
Gene ID - Rat ENSRNOG00000060103
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BEX4 pAb (ATL-HPA045105)
Datasheet Anti BEX4 pAb (ATL-HPA045105) Datasheet (External Link)
Vendor Page Anti BEX4 pAb (ATL-HPA045105) at Atlas Antibodies

Documents & Links for Anti BEX4 pAb (ATL-HPA045105)
Datasheet Anti BEX4 pAb (ATL-HPA045105) Datasheet (External Link)
Vendor Page Anti BEX4 pAb (ATL-HPA045105)