Anti BEX2 pAb (ATL-HPA078630)

Atlas Antibodies

Catalog No.:
ATL-HPA078630-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: brain expressed X-linked 2
Gene Name: BEX2
Alternative Gene Name: DJ79P11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042750: 77%, ENSRNOG00000032729: 77%
Entrez Gene ID: 84707
Uniprot ID: Q9BXY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLME
Gene Sequence RFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLME
Gene ID - Mouse ENSMUSG00000042750
Gene ID - Rat ENSRNOG00000032729
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BEX2 pAb (ATL-HPA078630)
Datasheet Anti BEX2 pAb (ATL-HPA078630) Datasheet (External Link)
Vendor Page Anti BEX2 pAb (ATL-HPA078630) at Atlas Antibodies

Documents & Links for Anti BEX2 pAb (ATL-HPA078630)
Datasheet Anti BEX2 pAb (ATL-HPA078630) Datasheet (External Link)
Vendor Page Anti BEX2 pAb (ATL-HPA078630)