Anti BEX2 pAb (ATL-HPA078630)
Atlas Antibodies
- Catalog No.:
- ATL-HPA078630-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BEX2
Alternative Gene Name: DJ79P11.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042750: 77%, ENSRNOG00000032729: 77%
Entrez Gene ID: 84707
Uniprot ID: Q9BXY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLME |
Gene Sequence | RFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLME |
Gene ID - Mouse | ENSMUSG00000042750 |
Gene ID - Rat | ENSRNOG00000032729 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BEX2 pAb (ATL-HPA078630) | |
Datasheet | Anti BEX2 pAb (ATL-HPA078630) Datasheet (External Link) |
Vendor Page | Anti BEX2 pAb (ATL-HPA078630) at Atlas Antibodies |
Documents & Links for Anti BEX2 pAb (ATL-HPA078630) | |
Datasheet | Anti BEX2 pAb (ATL-HPA078630) Datasheet (External Link) |
Vendor Page | Anti BEX2 pAb (ATL-HPA078630) |