Anti BEST4 pAb (ATL-HPA058564)

Atlas Antibodies

Catalog No.:
ATL-HPA058564-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: bestrophin 4
Gene Name: BEST4
Alternative Gene Name: VMD2L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029651: 39%, ENSRNOG00000010219: 41%
Entrez Gene ID: 266675
Uniprot ID: Q8NFU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDM
Gene Sequence LVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDM
Gene ID - Mouse ENSMUSG00000029651
Gene ID - Rat ENSRNOG00000010219
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BEST4 pAb (ATL-HPA058564)
Datasheet Anti BEST4 pAb (ATL-HPA058564) Datasheet (External Link)
Vendor Page Anti BEST4 pAb (ATL-HPA058564) at Atlas Antibodies

Documents & Links for Anti BEST4 pAb (ATL-HPA058564)
Datasheet Anti BEST4 pAb (ATL-HPA058564) Datasheet (External Link)
Vendor Page Anti BEST4 pAb (ATL-HPA058564)
Citations for Anti BEST4 pAb (ATL-HPA058564) – 1 Found
Fawkner-Corbett, David; Antanaviciute, Agne; Parikh, Kaushal; Jagielowicz, Marta; Gerós, Ana Sousa; Gupta, Tarun; Ashley, Neil; Khamis, Doran; Fowler, Darren; Morrissey, Edward; Cunningham, Chris; Johnson, Paul R V; Koohy, Hashem; Simmons, Alison. Spatiotemporal analysis of human intestinal development at single-cell resolution. Cell. 2021;184(3):810-826.e23.  PubMed