Anti BEST4 pAb (ATL-HPA058564)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058564-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BEST4
Alternative Gene Name: VMD2L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029651: 39%, ENSRNOG00000010219: 41%
Entrez Gene ID: 266675
Uniprot ID: Q8NFU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDM |
Gene Sequence | LVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDM |
Gene ID - Mouse | ENSMUSG00000029651 |
Gene ID - Rat | ENSRNOG00000010219 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BEST4 pAb (ATL-HPA058564) | |
Datasheet | Anti BEST4 pAb (ATL-HPA058564) Datasheet (External Link) |
Vendor Page | Anti BEST4 pAb (ATL-HPA058564) at Atlas Antibodies |
Documents & Links for Anti BEST4 pAb (ATL-HPA058564) | |
Datasheet | Anti BEST4 pAb (ATL-HPA058564) Datasheet (External Link) |
Vendor Page | Anti BEST4 pAb (ATL-HPA058564) |
Citations for Anti BEST4 pAb (ATL-HPA058564) – 1 Found |
Fawkner-Corbett, David; Antanaviciute, Agne; Parikh, Kaushal; Jagielowicz, Marta; Gerós, Ana Sousa; Gupta, Tarun; Ashley, Neil; Khamis, Doran; Fowler, Darren; Morrissey, Edward; Cunningham, Chris; Johnson, Paul R V; Koohy, Hashem; Simmons, Alison. Spatiotemporal analysis of human intestinal development at single-cell resolution. Cell. 2021;184(3):810-826.e23. PubMed |