Anti BEST2 pAb (ATL-HPA046229)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046229-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BEST2
Alternative Gene Name: FLJ20132, VMD2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052819: 65%, ENSRNOG00000003737: 68%
Entrez Gene ID: 54831
Uniprot ID: Q8NFU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP |
| Gene Sequence | RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP |
| Gene ID - Mouse | ENSMUSG00000052819 |
| Gene ID - Rat | ENSRNOG00000003737 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BEST2 pAb (ATL-HPA046229) | |
| Datasheet | Anti BEST2 pAb (ATL-HPA046229) Datasheet (External Link) |
| Vendor Page | Anti BEST2 pAb (ATL-HPA046229) at Atlas Antibodies |
| Documents & Links for Anti BEST2 pAb (ATL-HPA046229) | |
| Datasheet | Anti BEST2 pAb (ATL-HPA046229) Datasheet (External Link) |
| Vendor Page | Anti BEST2 pAb (ATL-HPA046229) |