Anti BEST2 pAb (ATL-HPA046229)

Atlas Antibodies

Catalog No.:
ATL-HPA046229-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: bestrophin 2
Gene Name: BEST2
Alternative Gene Name: FLJ20132, VMD2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052819: 65%, ENSRNOG00000003737: 68%
Entrez Gene ID: 54831
Uniprot ID: Q8NFU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP
Gene Sequence RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP
Gene ID - Mouse ENSMUSG00000052819
Gene ID - Rat ENSRNOG00000003737
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BEST2 pAb (ATL-HPA046229)
Datasheet Anti BEST2 pAb (ATL-HPA046229) Datasheet (External Link)
Vendor Page Anti BEST2 pAb (ATL-HPA046229) at Atlas Antibodies

Documents & Links for Anti BEST2 pAb (ATL-HPA046229)
Datasheet Anti BEST2 pAb (ATL-HPA046229) Datasheet (External Link)
Vendor Page Anti BEST2 pAb (ATL-HPA046229)