Anti BEND7 pAb (ATL-HPA037835)

Atlas Antibodies

SKU:
ATL-HPA037835-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BEN domain containing 7
Gene Name: BEND7
Alternative Gene Name: C10orf30, FLJ40283
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048186: 98%, ENSRNOG00000022712: 99%
Entrez Gene ID: 222389
Uniprot ID: Q8N7W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIK
Gene Sequence SILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIK
Gene ID - Mouse ENSMUSG00000048186
Gene ID - Rat ENSRNOG00000022712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BEND7 pAb (ATL-HPA037835)
Datasheet Anti BEND7 pAb (ATL-HPA037835) Datasheet (External Link)
Vendor Page Anti BEND7 pAb (ATL-HPA037835) at Atlas Antibodies

Documents & Links for Anti BEND7 pAb (ATL-HPA037835)
Datasheet Anti BEND7 pAb (ATL-HPA037835) Datasheet (External Link)
Vendor Page Anti BEND7 pAb (ATL-HPA037835)