Anti BEND5 pAb (ATL-HPA054347)

Atlas Antibodies

Catalog No.:
ATL-HPA054347-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BEN domain containing 5
Gene Name: BEND5
Alternative Gene Name: C1orf165, FLJ11588
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028545: 100%, ENSRNOG00000008025: 100%
Entrez Gene ID: 79656
Uniprot ID: Q7L4P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSG
Gene Sequence KEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSG
Gene ID - Mouse ENSMUSG00000028545
Gene ID - Rat ENSRNOG00000008025
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BEND5 pAb (ATL-HPA054347)
Datasheet Anti BEND5 pAb (ATL-HPA054347) Datasheet (External Link)
Vendor Page Anti BEND5 pAb (ATL-HPA054347) at Atlas Antibodies

Documents & Links for Anti BEND5 pAb (ATL-HPA054347)
Datasheet Anti BEND5 pAb (ATL-HPA054347) Datasheet (External Link)
Vendor Page Anti BEND5 pAb (ATL-HPA054347)