Anti BEND5 pAb (ATL-HPA054347)

Atlas Antibodies

Catalog No.: ATL-HPA054347-25

Protein Description: BEN domain containing 5
Gene Name: BEND5
Alternative Gene Name: C1orf165, FLJ11588
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028545: 100%, ENSRNOG00000008025: 100%
Entrez Gene ID: 79656
Uniprot ID: Q7L4P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSG
• Gene Sequence: KEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSG
• Gene ID - Mouse: ENSMUSG00000028545
• Gene ID - Rat: ENSRNOG00000008025
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.