Anti BEND5 pAb (ATL-HPA054347)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054347-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: BEND5
Alternative Gene Name: C1orf165, FLJ11588
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028545: 100%, ENSRNOG00000008025: 100%
Entrez Gene ID: 79656
Uniprot ID: Q7L4P6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSG |
| Gene Sequence | KEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSG |
| Gene ID - Mouse | ENSMUSG00000028545 |
| Gene ID - Rat | ENSRNOG00000008025 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BEND5 pAb (ATL-HPA054347) | |
| Datasheet | Anti BEND5 pAb (ATL-HPA054347) Datasheet (External Link) |
| Vendor Page | Anti BEND5 pAb (ATL-HPA054347) at Atlas Antibodies |
| Documents & Links for Anti BEND5 pAb (ATL-HPA054347) | |
| Datasheet | Anti BEND5 pAb (ATL-HPA054347) Datasheet (External Link) |
| Vendor Page | Anti BEND5 pAb (ATL-HPA054347) |