Anti BEND4 pAb (ATL-HPA036850)

Atlas Antibodies

SKU: ATL-HPA036850-25

• 
• 

Protein Description: BEN domain containing 4
Gene Name: BEND4
Alternative Gene Name: CCDC4, FLJ35632, FLJ43965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092060: 97%, ENSRNOG00000053303: 95%
Entrez Gene ID: 389206
Uniprot ID: Q6ZU67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTL
• Gene Sequence: QYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTL
• Gene ID - Mouse: ENSMUSG00000092060
• Gene ID - Rat: ENSRNOG00000053303
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.