Anti BEGAIN pAb (ATL-HPA002899 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA002899-25

• 
• 

Protein Description: brain-enriched guanylate kinase-associated
Gene Name: BEGAIN
Alternative Gene Name: KIAA1446
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040867: 78%, ENSRNOG00000004650: 81%
Entrez Gene ID: 57596
Uniprot ID: Q9BUH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSE
• Gene Sequence: PYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSE
• Gene ID - Mouse: ENSMUSG00000040867
• Gene ID - Rat: ENSRNOG00000004650
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BEGAIN pAb (ATL-HPA002899 w/enhanced validation) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.