Anti BECN1 pAb (ATL-HPA028949)
Atlas Antibodies
- SKU:
- ATL-HPA028949-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/86937/158573/atl-hpa028949_anti-becn1-pab-atl-hpa028949_40207__26515.1681109723.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue")
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: BECN1
Alternative Gene Name: ATG6, VPS30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035086: 99%, ENSRNOG00000020513: 98%
Entrez Gene ID: 8678
Uniprot ID: Q14457
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVT |
| Gene Sequence | CSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVT |
| Gene ID - Mouse | ENSMUSG00000035086 |
| Gene ID - Rat | ENSRNOG00000020513 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BECN1 pAb (ATL-HPA028949) | |
| Datasheet | Anti BECN1 pAb (ATL-HPA028949) Datasheet (External Link) |
| Vendor Page | Anti BECN1 pAb (ATL-HPA028949) at Atlas Antibodies |
| Documents & Links for Anti BECN1 pAb (ATL-HPA028949) | |
| Datasheet | Anti BECN1 pAb (ATL-HPA028949) Datasheet (External Link) |
| Vendor Page | Anti BECN1 pAb (ATL-HPA028949) |
| Citations for Anti BECN1 pAb (ATL-HPA028949) – 3 Found |
| Ziółkowska, Barbara; Woźniak, Marta; Ziółkowski, Piotr. Co-expression of autophagic markers following photodynamic therapy in SW620 human colon adenocarcinoma cells. Molecular Medicine Reports. 2016;14(3):2548-54. PubMed |
| Shin, Gu-Choul; Kang, Hong Seok; Lee, Ah Ram; Kim, Kyun-Hwan. Hepatitis B virus-triggered autophagy targets TNFRSF10B/death receptor 5 for degradation to limit TNFSF10/TRAIL response. Autophagy. 2016;12(12):2451-2466. PubMed |
| Lu, Linshan; Wang, Xiaohong; Zhao, Hongxi; Jiang, Feng; Li, Yanhong; Yao, Yuanqing; Shi, Changhong; Yang, Yanhong. MiR-291a/b-5p inhibits autophagy by targeting Atg5 and Becn1 during mouse preimplantation embryo development. Rsc Advances. 2019;9(16):9331-9341. PubMed |