Anti BECN1 pAb (ATL-HPA028949)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028949-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: BECN1
Alternative Gene Name: ATG6, VPS30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035086: 99%, ENSRNOG00000020513: 98%
Entrez Gene ID: 8678
Uniprot ID: Q14457
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVT |
Gene Sequence | CSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVT |
Gene ID - Mouse | ENSMUSG00000035086 |
Gene ID - Rat | ENSRNOG00000020513 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BECN1 pAb (ATL-HPA028949) | |
Datasheet | Anti BECN1 pAb (ATL-HPA028949) Datasheet (External Link) |
Vendor Page | Anti BECN1 pAb (ATL-HPA028949) at Atlas Antibodies |
Documents & Links for Anti BECN1 pAb (ATL-HPA028949) | |
Datasheet | Anti BECN1 pAb (ATL-HPA028949) Datasheet (External Link) |
Vendor Page | Anti BECN1 pAb (ATL-HPA028949) |
Citations for Anti BECN1 pAb (ATL-HPA028949) – 3 Found |
Ziółkowska, Barbara; Woźniak, Marta; Ziółkowski, Piotr. Co-expression of autophagic markers following photodynamic therapy in SW620 human colon adenocarcinoma cells. Molecular Medicine Reports. 2016;14(3):2548-54. PubMed |
Shin, Gu-Choul; Kang, Hong Seok; Lee, Ah Ram; Kim, Kyun-Hwan. Hepatitis B virus-triggered autophagy targets TNFRSF10B/death receptor 5 for degradation to limit TNFSF10/TRAIL response. Autophagy. 2016;12(12):2451-2466. PubMed |
Lu, Linshan; Wang, Xiaohong; Zhao, Hongxi; Jiang, Feng; Li, Yanhong; Yao, Yuanqing; Shi, Changhong; Yang, Yanhong. MiR-291a/b-5p inhibits autophagy by targeting Atg5 and Becn1 during mouse preimplantation embryo development. Rsc Advances. 2019;9(16):9331-9341. PubMed |