Anti BEAN1 pAb (ATL-HPA053851)

Atlas Antibodies

Catalog No.: ATL-HPA053851-25

Protein Description: brain expressed, associated with NEDD4, 1
Gene Name: BEAN1
Alternative Gene Name: SCA31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031872: 67%, ENSRNOG00000013301: 68%
Entrez Gene ID: 146227
Uniprot ID: Q3B7T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHREYEHGYVSDEHTYSRSSRRMRYACSSSEDWPPPLDISSDGD
• Gene Sequence: RHREYEHGYVSDEHTYSRSSRRMRYACSSSEDWPPPLDISSDGD
• Gene ID - Mouse: ENSMUSG00000031872
• Gene ID - Rat: ENSRNOG00000013301
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.