Anti BDKRB2 pAb (ATL-HPA050841)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050841-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: BDKRB2
Alternative Gene Name: BK-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021070: 50%, ENSRNOG00000047300: 47%
Entrez Gene ID: 624
Uniprot ID: P30411
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQP |
| Gene Sequence | FSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQP |
| Gene ID - Mouse | ENSMUSG00000021070 |
| Gene ID - Rat | ENSRNOG00000047300 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BDKRB2 pAb (ATL-HPA050841) | |
| Datasheet | Anti BDKRB2 pAb (ATL-HPA050841) Datasheet (External Link) |
| Vendor Page | Anti BDKRB2 pAb (ATL-HPA050841) at Atlas Antibodies |
| Documents & Links for Anti BDKRB2 pAb (ATL-HPA050841) | |
| Datasheet | Anti BDKRB2 pAb (ATL-HPA050841) Datasheet (External Link) |
| Vendor Page | Anti BDKRB2 pAb (ATL-HPA050841) |