Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030947-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: 3-hydroxybutyrate dehydrogenase, type 1
Gene Name: BDH1
Alternative Gene Name: BDH, SDR9C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046598: 90%, ENSRNOG00000001736: 91%
Entrez Gene ID: 622
Uniprot ID: Q02338
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHL
Gene Sequence ATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHL
Gene ID - Mouse ENSMUSG00000046598
Gene ID - Rat ENSRNOG00000001736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation)
Datasheet Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation)
Datasheet Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation)
Citations for Anti BDH1 pAb (ATL-HPA030947 w/enhanced validation) – 4 Found
Stagg, David B; Gillingham, Jacob R; Nelson, Alisa B; Lengfeld, Justin E; d'Avignon, D André; Puchalska, Patrycja; Crawford, Peter A. Diminished ketone interconversion, hepatic TCA cycle flux, and glucose production in D-β-hydroxybutyrate dehydrogenase hepatocyte-deficient mice. Molecular Metabolism. 2021;53( 34116232):101269.  PubMed
Liśkiewicz, Daniela; Liśkiewicz, Arkadiusz; Nowacka-Chmielewska, Marta M; Grabowski, Mateusz; Pondel, Natalia; Grabowska, Konstancja; Student, Sebastian; Barski, Jaroslaw J; Małecki, Andrzej. Differential Response of Hippocampal and Cerebrocortical Autophagy and Ketone Body Metabolism to the Ketogenic Diet. Frontiers In Cellular Neuroscience. 15( 34456688):733607.  PubMed
Scafidi, Susanna; Jernberg, Jennifer; Fiskum, Gary; McKenna, Mary C. Metabolism of Exogenous [2,4-(13)C]β-Hydroxybutyrate following Traumatic Brain Injury in 21-22-Day-Old Rats: An Ex Vivo NMR Study. Metabolites. 2022;12(8)  PubMed
Labanca, Estefania; Bizzotto, Juan; Sanchis, Pablo; Anselmino, Nicolas; Yang, Jun; Shepherd, Peter D A; Paez, Alejandra; Antico-Arciuch, Valeria; Lage-Vickers, Sofia; Hoang, Anh G; Tang, Ximing; Raso, Maria Gabriela; Titus, Mark; Efstathiou, Eleni; Cotignola, Javier; Araujo, John; Logothetis, Christopher; Vazquez, Elba; Navone, Nora; Gueron, Geraldine. Prostate cancer castrate resistant progression usage of non-canonical androgen receptor signaling and ketone body fuel. Oncogene. 2021;40(44):6284-6298.  PubMed