Anti BCS1L pAb (ATL-HPA037700)

Atlas Antibodies

SKU: ATL-HPA037700-25

• 

Protein Description: BC1 (ubiquinol-cytochrome c reductase) synthesis-like
Gene Name: BCS1L
Alternative Gene Name: BCS, BJS, h-BCS, Hs.6719
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026172: 92%, ENSRNOG00000016754: 94%
Entrez Gene ID: 617
Uniprot ID: Q9Y276
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAES
• Gene Sequence: RVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAES
• Gene ID - Mouse: ENSMUSG00000026172
• Gene ID - Rat: ENSRNOG00000016754
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.