Anti BCR pAb (ATL-HPA038337)

Atlas Antibodies

Catalog No.:
ATL-HPA038337-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: breakpoint cluster region
Gene Name: BCR
Alternative Gene Name: ALL, BCR1, CML, D22S11, D22S662, PHL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009681: 97%, ENSRNOG00000000417: 28%
Entrez Gene ID: 613
Uniprot ID: P11274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRW
Gene Sequence VDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRW
Gene ID - Mouse ENSMUSG00000009681
Gene ID - Rat ENSRNOG00000000417
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCR pAb (ATL-HPA038337)
Datasheet Anti BCR pAb (ATL-HPA038337) Datasheet (External Link)
Vendor Page Anti BCR pAb (ATL-HPA038337) at Atlas Antibodies

Documents & Links for Anti BCR pAb (ATL-HPA038337)
Datasheet Anti BCR pAb (ATL-HPA038337) Datasheet (External Link)
Vendor Page Anti BCR pAb (ATL-HPA038337)
Citations for Anti BCR pAb (ATL-HPA038337) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed