Anti BCR pAb (ATL-HPA038337)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038337-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BCR
Alternative Gene Name: ALL, BCR1, CML, D22S11, D22S662, PHL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009681: 97%, ENSRNOG00000000417: 28%
Entrez Gene ID: 613
Uniprot ID: P11274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRW |
Gene Sequence | VDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRW |
Gene ID - Mouse | ENSMUSG00000009681 |
Gene ID - Rat | ENSRNOG00000000417 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BCR pAb (ATL-HPA038337) | |
Datasheet | Anti BCR pAb (ATL-HPA038337) Datasheet (External Link) |
Vendor Page | Anti BCR pAb (ATL-HPA038337) at Atlas Antibodies |
Documents & Links for Anti BCR pAb (ATL-HPA038337) | |
Datasheet | Anti BCR pAb (ATL-HPA038337) Datasheet (External Link) |
Vendor Page | Anti BCR pAb (ATL-HPA038337) |
Citations for Anti BCR pAb (ATL-HPA038337) – 1 Found |
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |