Anti BCORL1 pAb (ATL-HPA031777)

Atlas Antibodies

SKU:
ATL-HPA031777-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BCL6 corepressor-like 1
Gene Name: BCORL1
Alternative Gene Name: CXorf10, FLJ11362
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036959: 90%, ENSRNOG00000005076: 93%
Entrez Gene ID: 63035
Uniprot ID: Q5H9F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSSDRIRMCGINEERRAPLSDEESTTGDCQHFGSQEFCVSSSFSKVELTAVGSGSNARGADPDGSATEKLGHKSEDKPDDPQPK
Gene Sequence TSSDRIRMCGINEERRAPLSDEESTTGDCQHFGSQEFCVSSSFSKVELTAVGSGSNARGADPDGSATEKLGHKSEDKPDDPQPK
Gene ID - Mouse ENSMUSG00000036959
Gene ID - Rat ENSRNOG00000005076
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BCORL1 pAb (ATL-HPA031777)
Datasheet Anti BCORL1 pAb (ATL-HPA031777) Datasheet (External Link)
Vendor Page Anti BCORL1 pAb (ATL-HPA031777) at Atlas Antibodies

Documents & Links for Anti BCORL1 pAb (ATL-HPA031777)
Datasheet Anti BCORL1 pAb (ATL-HPA031777) Datasheet (External Link)
Vendor Page Anti BCORL1 pAb (ATL-HPA031777)