Anti BCL7C pAb (ATL-HPA052654)

Atlas Antibodies

Catalog No.:
ATL-HPA052654-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: B-cell CLL/lymphoma 7C
Gene Name: BCL7C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030814: 96%, ENSRNOG00000018916: 98%
Entrez Gene ID: 9274
Uniprot ID: Q8WUZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPD
Gene Sequence MLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPD
Gene ID - Mouse ENSMUSG00000030814
Gene ID - Rat ENSRNOG00000018916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCL7C pAb (ATL-HPA052654)
Datasheet Anti BCL7C pAb (ATL-HPA052654) Datasheet (External Link)
Vendor Page Anti BCL7C pAb (ATL-HPA052654) at Atlas Antibodies

Documents & Links for Anti BCL7C pAb (ATL-HPA052654)
Datasheet Anti BCL7C pAb (ATL-HPA052654) Datasheet (External Link)
Vendor Page Anti BCL7C pAb (ATL-HPA052654)