Anti BCL7C pAb (ATL-HPA052654)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052654-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: BCL7C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030814: 96%, ENSRNOG00000018916: 98%
Entrez Gene ID: 9274
Uniprot ID: Q8WUZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPD |
| Gene Sequence | MLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPD |
| Gene ID - Mouse | ENSMUSG00000030814 |
| Gene ID - Rat | ENSRNOG00000018916 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCL7C pAb (ATL-HPA052654) | |
| Datasheet | Anti BCL7C pAb (ATL-HPA052654) Datasheet (External Link) |
| Vendor Page | Anti BCL7C pAb (ATL-HPA052654) at Atlas Antibodies |
| Documents & Links for Anti BCL7C pAb (ATL-HPA052654) | |
| Datasheet | Anti BCL7C pAb (ATL-HPA052654) Datasheet (External Link) |
| Vendor Page | Anti BCL7C pAb (ATL-HPA052654) |