Anti BCL7B pAb (ATL-HPA058069)

Atlas Antibodies

Catalog No.:
ATL-HPA058069-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: B-cell CLL/lymphoma 7B
Gene Name: BCL7B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029681: 88%, ENSRNOG00000032705: 88%
Entrez Gene ID: 9275
Uniprot ID: Q9BQE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Gene Sequence LTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Gene ID - Mouse ENSMUSG00000029681
Gene ID - Rat ENSRNOG00000032705
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCL7B pAb (ATL-HPA058069)
Datasheet Anti BCL7B pAb (ATL-HPA058069) Datasheet (External Link)
Vendor Page Anti BCL7B pAb (ATL-HPA058069) at Atlas Antibodies

Documents & Links for Anti BCL7B pAb (ATL-HPA058069)
Datasheet Anti BCL7B pAb (ATL-HPA058069) Datasheet (External Link)
Vendor Page Anti BCL7B pAb (ATL-HPA058069)