Anti BCL7A pAb (ATL-HPA019762)

Atlas Antibodies

Catalog No.:
ATL-HPA019762-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: B-cell CLL/lymphoma 7A
Gene Name: BCL7A
Alternative Gene Name: BCL7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029438: 89%, ENSRNOG00000056017: 90%
Entrez Gene ID: 605
Uniprot ID: Q4VC05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE
Gene Sequence QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE
Gene ID - Mouse ENSMUSG00000029438
Gene ID - Rat ENSRNOG00000056017
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCL7A pAb (ATL-HPA019762)
Datasheet Anti BCL7A pAb (ATL-HPA019762) Datasheet (External Link)
Vendor Page Anti BCL7A pAb (ATL-HPA019762) at Atlas Antibodies

Documents & Links for Anti BCL7A pAb (ATL-HPA019762)
Datasheet Anti BCL7A pAb (ATL-HPA019762) Datasheet (External Link)
Vendor Page Anti BCL7A pAb (ATL-HPA019762)
Citations for Anti BCL7A pAb (ATL-HPA019762) – 3 Found
Beon, Jiyoon; Han, Sungwook; Yang, Hyeokjun; Park, Seung Eun; Hyun, Kwangbeom; Lee, Song-Yi; Rhee, Hyun-Woo; Seo, Jeong Kon; Kim, Jaehoon; Kim, Seyun; Lee, Daeyoup. Inositol polyphosphate multikinase physically binds to the SWI/SNF complex and modulates BRG1 occupancy in mouse embryonic stem cells. Elife. 2022;11( 35551737)  PubMed
Pan, Jianbo; Yu, Lili; Wu, Qingwei; Lin, Xiaoqing; Liu, Shuang; Hu, Shaohui; Rosa, Christian; Eichinger, Daniel; Pino, Ignacio; Zhu, Heng; Qian, Jiang; Huang, Yi. Integration of IgA and IgG Autoantigens Improves Performance of Biomarker Panels for Early Diagnosis of Lung Cancer. Molecular & Cellular Proteomics : Mcp. 2020;19(3):490-500.  PubMed
Wischhof, Lena; Lee, Hang-Mao; Tutas, Janine; Overkott, Clemens; Tedt, Eileen; Stork, Miriam; Peitz, Michael; Brüstle, Oliver; Ulas, Thomas; Händler, Kristian; Schultze, Joachim L; Ehninger, Dan; Nicotera, Pierluigi; Salomoni, Paolo; Bano, Daniele. BCL7A-containing SWI/SNF/BAF complexes modulate mitochondrial bioenergetics during neural progenitor differentiation. The Embo Journal. 2022;41(23):e110595.  PubMed