Anti BCL6B pAb (ATL-HPA075112)

Atlas Antibodies

Catalog No.:
ATL-HPA075112-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: B-cell CLL/lymphoma 6B
Gene Name: BCL6B
Alternative Gene Name: BAZF, ZBTB28, ZNF62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000317: 88%, ENSRNOG00000059956: 93%
Entrez Gene ID: 255877
Uniprot ID: Q8N143
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAP
Gene Sequence YLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAP
Gene ID - Mouse ENSMUSG00000000317
Gene ID - Rat ENSRNOG00000059956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCL6B pAb (ATL-HPA075112)
Datasheet Anti BCL6B pAb (ATL-HPA075112) Datasheet (External Link)
Vendor Page Anti BCL6B pAb (ATL-HPA075112) at Atlas Antibodies

Documents & Links for Anti BCL6B pAb (ATL-HPA075112)
Datasheet Anti BCL6B pAb (ATL-HPA075112) Datasheet (External Link)
Vendor Page Anti BCL6B pAb (ATL-HPA075112)