Anti BCL6 pAb (ATL-HPA004899 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA004899-25
  • Immunohistochemistry analysis in human tonsil and pancreas tissues using HPA004899 antibody. Corresponding BCL6 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: B-cell CLL/lymphoma 6
Gene Name: BCL6
Alternative Gene Name: BCL5, BCL6A, LAZ3, ZBTB27, ZNF51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022508: 95%, ENSRNOG00000001843: 94%
Entrez Gene ID: 604
Uniprot ID: P41182
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS
Gene Sequence NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS
Gene ID - Mouse ENSMUSG00000022508
Gene ID - Rat ENSRNOG00000001843
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BCL6 pAb (ATL-HPA004899 w/enhanced validation)
Datasheet Anti BCL6 pAb (ATL-HPA004899 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCL6 pAb (ATL-HPA004899 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BCL6 pAb (ATL-HPA004899 w/enhanced validation)
Datasheet Anti BCL6 pAb (ATL-HPA004899 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCL6 pAb (ATL-HPA004899 w/enhanced validation)



Citations for Anti BCL6 pAb (ATL-HPA004899 w/enhanced validation) – 4 Found
Wehrhan, Falk; Gross, Christian; Creutzburg, Kay; Amann, Kerstin; Ries, Jutta; Kesting, Marco; Geppert, Carol-Immanuel; Weber, Manuel. Osteoclastic expression of higher-level regulators NFATc1 and BCL6 in medication-related osteonecrosis of the jaw secondary to bisphosphonate therapy: a comparison with osteoradionecrosis and osteomyelitis. Journal Of Translational Medicine. 2019;17(1):69.  PubMed
Crnogorac-Jurcevic, Tatjana; Chelala, Claude; Barry, Sayka; Harada, Tomohiko; Bhakta, Vipul; Lattimore, Sam; Jurcevic, Stipo; Bronner, Mary; Lemoine, Nicholas R; Brentnall, Teresa A. Molecular analysis of precursor lesions in familial pancreatic cancer. Plos One. 8(1):e54830.  PubMed
Schlager, Stefanie; Salomon, Carina; Olt, Sabine; Albrecht, Christoph; Ebert, Anja; Bergner, Oliver; Wachter, Johannes; Trapani, Francesca; Gerlach, Daniel; Voss, Tilman; Traunbauer, Anna; Jude, Julian; Hinterndorfer, Matthias; Minnich, Martina; Schweifer, Norbert; Blake, Sophia M; Zinzalla, Vittoria; Drobits, Barbara; McConnell, Darryl B; Kraut, Norbert; Pearson, Mark; Zuber, Johannes; Koegl, Manfred. Inducible knock-out of BCL6 in lymphoma cells results in tumor stasis. Oncotarget. 2020;11(9):875-890.  PubMed
Fang, Shuo-Gui; Xia, Tian-Liang; Fu, Jian-Chang; Li, Tong; Zhong, Qian; Han, Fei. BCL6-SPECC1L: A Novel Fusion Gene in Nasopharyngeal Carcinoma. Technology In Cancer Research & Treatment. 2022;21( 36412101):15330338221139981.  PubMed