Anti BCL3 pAb (ATL-HPA047514)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047514-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BCL3
Alternative Gene Name: BCL4, D19S37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053175: 91%, ENSRNOG00000043416: 92%
Entrez Gene ID: 602
Uniprot ID: P20749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN |
Gene Sequence | AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN |
Gene ID - Mouse | ENSMUSG00000053175 |
Gene ID - Rat | ENSRNOG00000043416 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BCL3 pAb (ATL-HPA047514) | |
Datasheet | Anti BCL3 pAb (ATL-HPA047514) Datasheet (External Link) |
Vendor Page | Anti BCL3 pAb (ATL-HPA047514) at Atlas Antibodies |
Documents & Links for Anti BCL3 pAb (ATL-HPA047514) | |
Datasheet | Anti BCL3 pAb (ATL-HPA047514) Datasheet (External Link) |
Vendor Page | Anti BCL3 pAb (ATL-HPA047514) |