Anti BCL3 pAb (ATL-HPA047514)

Atlas Antibodies

SKU:
ATL-HPA047514-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm, cytosol, midbody & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: B-cell CLL/lymphoma 3
Gene Name: BCL3
Alternative Gene Name: BCL4, D19S37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053175: 91%, ENSRNOG00000043416: 92%
Entrez Gene ID: 602
Uniprot ID: P20749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN
Gene Sequence AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN
Gene ID - Mouse ENSMUSG00000053175
Gene ID - Rat ENSRNOG00000043416
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BCL3 pAb (ATL-HPA047514)
Datasheet Anti BCL3 pAb (ATL-HPA047514) Datasheet (External Link)
Vendor Page Anti BCL3 pAb (ATL-HPA047514) at Atlas Antibodies

Documents & Links for Anti BCL3 pAb (ATL-HPA047514)
Datasheet Anti BCL3 pAb (ATL-HPA047514) Datasheet (External Link)
Vendor Page Anti BCL3 pAb (ATL-HPA047514)