Anti BCL2L15 pAb (ATL-HPA029732)

Atlas Antibodies

Catalog No.:
ATL-HPA029732-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BCL2-like 15
Gene Name: BCL2L15
Alternative Gene Name: Bfk, C1orf178, FLJ22588
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044165: 69%, ENSRNOG00000037149: 73%
Entrez Gene ID: 440603
Uniprot ID: Q5TBC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEASAKNVIAETIKG
Gene Sequence CIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEASAKNVIAETIKG
Gene ID - Mouse ENSMUSG00000044165
Gene ID - Rat ENSRNOG00000037149
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCL2L15 pAb (ATL-HPA029732)
Datasheet Anti BCL2L15 pAb (ATL-HPA029732) Datasheet (External Link)
Vendor Page Anti BCL2L15 pAb (ATL-HPA029732) at Atlas Antibodies

Documents & Links for Anti BCL2L15 pAb (ATL-HPA029732)
Datasheet Anti BCL2L15 pAb (ATL-HPA029732) Datasheet (External Link)
Vendor Page Anti BCL2L15 pAb (ATL-HPA029732)