Anti BCL2L15 pAb (ATL-HPA029732)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029732-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BCL2L15
Alternative Gene Name: Bfk, C1orf178, FLJ22588
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044165: 69%, ENSRNOG00000037149: 73%
Entrez Gene ID: 440603
Uniprot ID: Q5TBC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEASAKNVIAETIKG |
Gene Sequence | CIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEASAKNVIAETIKG |
Gene ID - Mouse | ENSMUSG00000044165 |
Gene ID - Rat | ENSRNOG00000037149 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BCL2L15 pAb (ATL-HPA029732) | |
Datasheet | Anti BCL2L15 pAb (ATL-HPA029732) Datasheet (External Link) |
Vendor Page | Anti BCL2L15 pAb (ATL-HPA029732) at Atlas Antibodies |
Documents & Links for Anti BCL2L15 pAb (ATL-HPA029732) | |
Datasheet | Anti BCL2L15 pAb (ATL-HPA029732) Datasheet (External Link) |
Vendor Page | Anti BCL2L15 pAb (ATL-HPA029732) |