Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA040665-25

• 
• 
• 

Protein Description: BCL2-like 14 (apoptosis facilitator)
Gene Name: BCL2L14
Alternative Gene Name: BCL-G, BCLG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030200: 52%, ENSRNOG00000028632: 56%
Entrez Gene ID: 79370
Uniprot ID: Q9BZR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL
• Gene Sequence: GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL
• Gene ID - Mouse: ENSMUSG00000030200
• Gene ID - Rat: ENSRNOG00000028632
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) – 1 Found

Woznicki, Jerzy A; Flood, Peter; Bustamante-Garrido, Milan; Stamou, Panagiota; Moloney, Gerry; Fanning, Aine; Zulquernain, Syed Akbar; McCarthy, Jane; Shanahan, Fergus; Melgar, Silvia; Nally, Ken. Human BCL-G regulates secretion of inflammatory chemokines but is dispensable for induction of apoptosis by IFN-γ and TNF-α in intestinal epithelial cells. Cell Death & Disease. 2020;11(1):68.