Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040665-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BCL2L14
Alternative Gene Name: BCL-G, BCLG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030200: 52%, ENSRNOG00000028632: 56%
Entrez Gene ID: 79370
Uniprot ID: Q9BZR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL |
Gene Sequence | GQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELL |
Gene ID - Mouse | ENSMUSG00000030200 |
Gene ID - Rat | ENSRNOG00000028632 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) | |
Datasheet | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) | |
Datasheet | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) |
Citations for Anti BCL2L14 pAb (ATL-HPA040665 w/enhanced validation) – 1 Found |
Woznicki, Jerzy A; Flood, Peter; Bustamante-Garrido, Milan; Stamou, Panagiota; Moloney, Gerry; Fanning, Aine; Zulquernain, Syed Akbar; McCarthy, Jane; Shanahan, Fergus; Melgar, Silvia; Nally, Ken. Human BCL-G regulates secretion of inflammatory chemokines but is dispensable for induction of apoptosis by IFN-γ and TNF-α in intestinal epithelial cells. Cell Death & Disease. 2020;11(1):68. PubMed |