Anti BCL2L13 pAb (ATL-HPA030994)

Atlas Antibodies

SKU: ATL-HPA030994-100

• 
• 
• 

Protein Description: BCL2-like 13 (apoptosis facilitator)
Gene Name: BCL2L13
Alternative Gene Name: BCL-RAMBO, MIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009112: 89%, ENSRNOG00000012394: 90%
Entrez Gene ID: 23786
Uniprot ID: Q9BXK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QFGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSE
• Gene Sequence: QFGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSE
• Gene ID - Mouse: ENSMUSG00000009112
• Gene ID - Rat: ENSRNOG00000012394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.