Anti BCL2L12 pAb (ATL-HPA020856)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020856-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BCL2L12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003190: 84%, ENSRNOG00000020486: 86%
Entrez Gene ID: 83596
Uniprot ID: Q9HB09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQK |
| Gene Sequence | PSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQK |
| Gene ID - Mouse | ENSMUSG00000003190 |
| Gene ID - Rat | ENSRNOG00000020486 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCL2L12 pAb (ATL-HPA020856) | |
| Datasheet | Anti BCL2L12 pAb (ATL-HPA020856) Datasheet (External Link) |
| Vendor Page | Anti BCL2L12 pAb (ATL-HPA020856) at Atlas Antibodies |
| Documents & Links for Anti BCL2L12 pAb (ATL-HPA020856) | |
| Datasheet | Anti BCL2L12 pAb (ATL-HPA020856) Datasheet (External Link) |
| Vendor Page | Anti BCL2L12 pAb (ATL-HPA020856) |