Anti BCL2L12 pAb (ATL-HPA020856)

Atlas Antibodies

Catalog No.:
ATL-HPA020856-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: BCL2-like 12 (proline rich)
Gene Name: BCL2L12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003190: 84%, ENSRNOG00000020486: 86%
Entrez Gene ID: 83596
Uniprot ID: Q9HB09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQK
Gene Sequence PSESPRPCSLPIRPCYGLEPGPATPDFYALVAQRLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQK
Gene ID - Mouse ENSMUSG00000003190
Gene ID - Rat ENSRNOG00000020486
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCL2L12 pAb (ATL-HPA020856)
Datasheet Anti BCL2L12 pAb (ATL-HPA020856) Datasheet (External Link)
Vendor Page Anti BCL2L12 pAb (ATL-HPA020856) at Atlas Antibodies

Documents & Links for Anti BCL2L12 pAb (ATL-HPA020856)
Datasheet Anti BCL2L12 pAb (ATL-HPA020856) Datasheet (External Link)
Vendor Page Anti BCL2L12 pAb (ATL-HPA020856)