Anti BCL2L10 pAb (ATL-HPA042222)

Atlas Antibodies

Catalog No.:
ATL-HPA042222-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: BCL2-like 10 (apoptosis facilitator)
Gene Name: BCL2L10
Alternative Gene Name: BCL-B, Boo, Diva
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032191: 42%, ENSRNOG00000009308: 39%
Entrez Gene ID: 10017
Uniprot ID: Q9HD36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVDQLRERTTMADPLRERTELLLADYLGYCARE
Gene Sequence MVDQLRERTTMADPLRERTELLLADYLGYCARE
Gene ID - Mouse ENSMUSG00000032191
Gene ID - Rat ENSRNOG00000009308
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCL2L10 pAb (ATL-HPA042222)
Datasheet Anti BCL2L10 pAb (ATL-HPA042222) Datasheet (External Link)
Vendor Page Anti BCL2L10 pAb (ATL-HPA042222) at Atlas Antibodies

Documents & Links for Anti BCL2L10 pAb (ATL-HPA042222)
Datasheet Anti BCL2L10 pAb (ATL-HPA042222) Datasheet (External Link)
Vendor Page Anti BCL2L10 pAb (ATL-HPA042222)