Anti BCL2L10 pAb (ATL-HPA042222)

Atlas Antibodies

Catalog No.: ATL-HPA042222-25

Protein Description: BCL2-like 10 (apoptosis facilitator)
Gene Name: BCL2L10
Alternative Gene Name: BCL-B, Boo, Diva
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032191: 42%, ENSRNOG00000009308: 39%
Entrez Gene ID: 10017
Uniprot ID: Q9HD36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVDQLRERTTMADPLRERTELLLADYLGYCARE
• Gene Sequence: MVDQLRERTTMADPLRERTELLLADYLGYCARE
• Gene ID - Mouse: ENSMUSG00000032191
• Gene ID - Rat: ENSRNOG00000009308
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.