Anti BCL2L10 pAb (ATL-HPA042222)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042222-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BCL2L10
Alternative Gene Name: BCL-B, Boo, Diva
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032191: 42%, ENSRNOG00000009308: 39%
Entrez Gene ID: 10017
Uniprot ID: Q9HD36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVDQLRERTTMADPLRERTELLLADYLGYCARE |
| Gene Sequence | MVDQLRERTTMADPLRERTELLLADYLGYCARE |
| Gene ID - Mouse | ENSMUSG00000032191 |
| Gene ID - Rat | ENSRNOG00000009308 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCL2L10 pAb (ATL-HPA042222) | |
| Datasheet | Anti BCL2L10 pAb (ATL-HPA042222) Datasheet (External Link) |
| Vendor Page | Anti BCL2L10 pAb (ATL-HPA042222) at Atlas Antibodies |
| Documents & Links for Anti BCL2L10 pAb (ATL-HPA042222) | |
| Datasheet | Anti BCL2L10 pAb (ATL-HPA042222) Datasheet (External Link) |
| Vendor Page | Anti BCL2L10 pAb (ATL-HPA042222) |