Anti BCL2L1 pAb (ATL-HPA035734)

Atlas Antibodies

Catalog No.:
ATL-HPA035734-25
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: BCL2-like 1
Gene Name: BCL2L1
Alternative Gene Name: Bcl-X, bcl-xL, bcl-xS, BCL2L, BCLX, PPP1R52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007659: 96%, ENSRNOG00000007946: 96%
Entrez Gene ID: 598
Uniprot ID: Q07817
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
Gene Sequence MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
Gene ID - Mouse ENSMUSG00000007659
Gene ID - Rat ENSRNOG00000007946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCL2L1 pAb (ATL-HPA035734)
Datasheet Anti BCL2L1 pAb (ATL-HPA035734) Datasheet (External Link)
Vendor Page Anti BCL2L1 pAb (ATL-HPA035734) at Atlas Antibodies

Documents & Links for Anti BCL2L1 pAb (ATL-HPA035734)
Datasheet Anti BCL2L1 pAb (ATL-HPA035734) Datasheet (External Link)
Vendor Page Anti BCL2L1 pAb (ATL-HPA035734)
Citations for Anti BCL2L1 pAb (ATL-HPA035734) – 1 Found
Borrás, Consuelo; Mas-Bargues, Cristina; Román-Domínguez, Aurora; Sanz-Ros, Jorge; Gimeno-Mallench, Lucia; Inglés, Marta; Gambini, Juan; Viña, José. BCL-xL, a Mitochondrial Protein Involved in Successful Aging: From C. elegans to Human Centenarians. International Journal Of Molecular Sciences. 2020;21(2)  PubMed
!