Anti BCL10 pAb (ATL-HPA017925 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA017925-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: B-cell CLL/lymphoma 10
Gene Name: BCL10
Alternative Gene Name: c-E10, CARMEN, CIPER, CLAP, mE10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028191: 97%, ENSRNOG00000042389: 97%
Entrez Gene ID: 8915
Uniprot ID: O95999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRT
Gene Sequence MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRT
Gene ID - Mouse ENSMUSG00000028191
Gene ID - Rat ENSRNOG00000042389
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCL10 pAb (ATL-HPA017925 w/enhanced validation)
Datasheet Anti BCL10 pAb (ATL-HPA017925 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCL10 pAb (ATL-HPA017925 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BCL10 pAb (ATL-HPA017925 w/enhanced validation)
Datasheet Anti BCL10 pAb (ATL-HPA017925 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCL10 pAb (ATL-HPA017925 w/enhanced validation)