Anti BCL10 pAb (ATL-HPA017925 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017925-25

• 
• 

Protein Description: B-cell CLL/lymphoma 10
Gene Name: BCL10
Alternative Gene Name: c-E10, CARMEN, CIPER, CLAP, mE10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028191: 97%, ENSRNOG00000042389: 97%
Entrez Gene ID: 8915
Uniprot ID: O95999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRT
• Gene Sequence: MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRT
• Gene ID - Mouse: ENSMUSG00000028191
• Gene ID - Rat: ENSRNOG00000042389
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.