Anti BCKDK pAb (ATL-HPA017995)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017995-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BCKDK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030802: 99%, ENSRNOG00000019485: 100%
Entrez Gene ID: 10295
Uniprot ID: O14874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY |
Gene Sequence | LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY |
Gene ID - Mouse | ENSMUSG00000030802 |
Gene ID - Rat | ENSRNOG00000019485 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BCKDK pAb (ATL-HPA017995) | |
Datasheet | Anti BCKDK pAb (ATL-HPA017995) Datasheet (External Link) |
Vendor Page | Anti BCKDK pAb (ATL-HPA017995) at Atlas Antibodies |
Documents & Links for Anti BCKDK pAb (ATL-HPA017995) | |
Datasheet | Anti BCKDK pAb (ATL-HPA017995) Datasheet (External Link) |
Vendor Page | Anti BCKDK pAb (ATL-HPA017995) |
Citations for Anti BCKDK pAb (ATL-HPA017995) – 1 Found |
Neinast, Michael D; Jang, Cholsoon; Hui, Sheng; Murashige, Danielle S; Chu, Qingwei; Morscher, Raphael J; Li, Xiaoxuan; Zhan, Le; White, Eileen; Anthony, Tracy G; Rabinowitz, Joshua D; Arany, Zoltan. Quantitative Analysis of the Whole-Body Metabolic Fate of Branched-Chain Amino Acids. Cell Metabolism. 2019;29(2):417-429.e4. PubMed |