Anti BCKDK pAb (ATL-HPA017995)

Atlas Antibodies

SKU: ATL-HPA017995-25

• 
• 

Protein Description: branched chain ketoacid dehydrogenase kinase
Gene Name: BCKDK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030802: 99%, ENSRNOG00000019485: 100%
Entrez Gene ID: 10295
Uniprot ID: O14874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY
• Gene Sequence: LLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDY
• Gene ID - Mouse: ENSMUSG00000030802
• Gene ID - Rat: ENSRNOG00000019485
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BCKDK pAb (ATL-HPA017995) – 1 Found

Neinast, Michael D; Jang, Cholsoon; Hui, Sheng; Murashige, Danielle S; Chu, Qingwei; Morscher, Raphael J; Li, Xiaoxuan; Zhan, Le; White, Eileen; Anthony, Tracy G; Rabinowitz, Joshua D; Arany, Zoltan. Quantitative Analysis of the Whole-Body Metabolic Fate of Branched-Chain Amino Acids. Cell Metabolism. 2019;29(2):417-429.e4.