Anti BCKDHB pAb (ATL-HPA031580)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031580-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: BCKDHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032263: 90%, ENSRNOG00000009928: 92%
Entrez Gene ID: 594
Uniprot ID: P21953
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD |
| Gene Sequence | QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD |
| Gene ID - Mouse | ENSMUSG00000032263 |
| Gene ID - Rat | ENSRNOG00000009928 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCKDHB pAb (ATL-HPA031580) | |
| Datasheet | Anti BCKDHB pAb (ATL-HPA031580) Datasheet (External Link) |
| Vendor Page | Anti BCKDHB pAb (ATL-HPA031580) at Atlas Antibodies |
| Documents & Links for Anti BCKDHB pAb (ATL-HPA031580) | |
| Datasheet | Anti BCKDHB pAb (ATL-HPA031580) Datasheet (External Link) |
| Vendor Page | Anti BCKDHB pAb (ATL-HPA031580) |