Anti BCKDHA pAb (ATL-HPA036640)

Atlas Antibodies

SKU: ATL-HPA036640-25

• 

Protein Description: branched chain keto acid dehydrogenase E1, alpha polypeptide
Gene Name: BCKDHA
Alternative Gene Name: MSU, OVD1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060376: 94%, ENSRNOG00000020607: 94%
Entrez Gene ID: 593
Uniprot ID: P12694
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH
• Gene Sequence: EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH
• Gene ID - Mouse: ENSMUSG00000060376
• Gene ID - Rat: ENSRNOG00000020607
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.