Anti BCKDHA pAb (ATL-HPA036640)

Atlas Antibodies

Catalog No.:
ATL-HPA036640-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: branched chain keto acid dehydrogenase E1, alpha polypeptide
Gene Name: BCKDHA
Alternative Gene Name: MSU, OVD1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060376: 94%, ENSRNOG00000020607: 94%
Entrez Gene ID: 593
Uniprot ID: P12694
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH
Gene Sequence EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH
Gene ID - Mouse ENSMUSG00000060376
Gene ID - Rat ENSRNOG00000020607
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCKDHA pAb (ATL-HPA036640)
Datasheet Anti BCKDHA pAb (ATL-HPA036640) Datasheet (External Link)
Vendor Page Anti BCKDHA pAb (ATL-HPA036640) at Atlas Antibodies

Documents & Links for Anti BCKDHA pAb (ATL-HPA036640)
Datasheet Anti BCKDHA pAb (ATL-HPA036640) Datasheet (External Link)
Vendor Page Anti BCKDHA pAb (ATL-HPA036640)