Anti BCKDHA pAb (ATL-HPA036640)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036640-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BCKDHA
Alternative Gene Name: MSU, OVD1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060376: 94%, ENSRNOG00000020607: 94%
Entrez Gene ID: 593
Uniprot ID: P12694
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH |
Gene Sequence | EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDH |
Gene ID - Mouse | ENSMUSG00000060376 |
Gene ID - Rat | ENSRNOG00000020607 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BCKDHA pAb (ATL-HPA036640) | |
Datasheet | Anti BCKDHA pAb (ATL-HPA036640) Datasheet (External Link) |
Vendor Page | Anti BCKDHA pAb (ATL-HPA036640) at Atlas Antibodies |
Documents & Links for Anti BCKDHA pAb (ATL-HPA036640) | |
Datasheet | Anti BCKDHA pAb (ATL-HPA036640) Datasheet (External Link) |
Vendor Page | Anti BCKDHA pAb (ATL-HPA036640) |