Anti BCCIP pAb (ATL-HPA038011)

Atlas Antibodies

Catalog No.:
ATL-HPA038011-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BRCA2 and CDKN1A interacting protein
Gene Name: BCCIP
Alternative Gene Name: BCCIPalpha, TOK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030983: 57%, ENSRNOG00000018066: 54%
Entrez Gene ID: 56647
Uniprot ID: Q9P287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALPMYQQLQKELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEEQGKPEVLGGPDTRRGLEPVPIQHNGGSR
Gene Sequence ALPMYQQLQKELAGAHRTNKPCGKCYFYLLISKTFVEAGKNNSKKKPSNKKKAALMFANAEEEFFYEEQGKPEVLGGPDTRRGLEPVPIQHNGGSR
Gene ID - Mouse ENSMUSG00000030983
Gene ID - Rat ENSRNOG00000018066
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCCIP pAb (ATL-HPA038011)
Datasheet Anti BCCIP pAb (ATL-HPA038011) Datasheet (External Link)
Vendor Page Anti BCCIP pAb (ATL-HPA038011) at Atlas Antibodies

Documents & Links for Anti BCCIP pAb (ATL-HPA038011)
Datasheet Anti BCCIP pAb (ATL-HPA038011) Datasheet (External Link)
Vendor Page Anti BCCIP pAb (ATL-HPA038011)