Anti BCAT2 pAb (ATL-HPA054091 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA054091-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: branched chain amino-acid transaminase 2, mitochondrial
Gene Name: BCAT2
Alternative Gene Name: BCAM, BCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030826: 73%, ENSRNOG00000020956: 70%
Entrez Gene ID: 587
Uniprot ID: O15382
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML
Gene Sequence MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML
Gene ID - Mouse ENSMUSG00000030826
Gene ID - Rat ENSRNOG00000020956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCAT2 pAb (ATL-HPA054091 w/enhanced validation)
Datasheet Anti BCAT2 pAb (ATL-HPA054091 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAT2 pAb (ATL-HPA054091 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BCAT2 pAb (ATL-HPA054091 w/enhanced validation)
Datasheet Anti BCAT2 pAb (ATL-HPA054091 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAT2 pAb (ATL-HPA054091 w/enhanced validation)