Anti BCAT2 pAb (ATL-HPA054091 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA054091-25

Protein Description: branched chain amino-acid transaminase 2, mitochondrial
Gene Name: BCAT2
Alternative Gene Name: BCAM, BCT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030826: 73%, ENSRNOG00000020956: 70%
Entrez Gene ID: 587
Uniprot ID: O15382
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML
• Gene Sequence: MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHML
• Gene ID - Mouse: ENSMUSG00000030826
• Gene ID - Rat: ENSRNOG00000020956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.