Anti BCAS3 pAb (ATL-HPA057289)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057289-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BCAS3
Alternative Gene Name: FLJ20128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059439: 95%, ENSRNOG00000017027: 21%
Entrez Gene ID: 54828
Uniprot ID: Q9H6U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ |
| Gene Sequence | PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ |
| Gene ID - Mouse | ENSMUSG00000059439 |
| Gene ID - Rat | ENSRNOG00000017027 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCAS3 pAb (ATL-HPA057289) | |
| Datasheet | Anti BCAS3 pAb (ATL-HPA057289) Datasheet (External Link) |
| Vendor Page | Anti BCAS3 pAb (ATL-HPA057289) at Atlas Antibodies |
| Documents & Links for Anti BCAS3 pAb (ATL-HPA057289) | |
| Datasheet | Anti BCAS3 pAb (ATL-HPA057289) Datasheet (External Link) |
| Vendor Page | Anti BCAS3 pAb (ATL-HPA057289) |