Anti BCAS3 pAb (ATL-HPA057289)

Atlas Antibodies

Catalog No.: ATL-HPA057289-25

Protein Description: breast carcinoma amplified sequence 3
Gene Name: BCAS3
Alternative Gene Name: FLJ20128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059439: 95%, ENSRNOG00000017027: 21%
Entrez Gene ID: 54828
Uniprot ID: Q9H6U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ
• Gene Sequence: PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ
• Gene ID - Mouse: ENSMUSG00000059439
• Gene ID - Rat: ENSRNOG00000017027
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.