Anti BCAS3 pAb (ATL-HPA057289)

Atlas Antibodies

Catalog No.:
ATL-HPA057289-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: breast carcinoma amplified sequence 3
Gene Name: BCAS3
Alternative Gene Name: FLJ20128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059439: 95%, ENSRNOG00000017027: 21%
Entrez Gene ID: 54828
Uniprot ID: Q9H6U6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ
Gene Sequence PRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGSEPPLLIMIGYSDGMQVWSIPISGEAQ
Gene ID - Mouse ENSMUSG00000059439
Gene ID - Rat ENSRNOG00000017027
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCAS3 pAb (ATL-HPA057289)
Datasheet Anti BCAS3 pAb (ATL-HPA057289) Datasheet (External Link)
Vendor Page Anti BCAS3 pAb (ATL-HPA057289) at Atlas Antibodies

Documents & Links for Anti BCAS3 pAb (ATL-HPA057289)
Datasheet Anti BCAS3 pAb (ATL-HPA057289) Datasheet (External Link)
Vendor Page Anti BCAS3 pAb (ATL-HPA057289)