Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA014858-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: breast cancer anti-estrogen resistance 3
Gene Name: BCAR3
Alternative Gene Name: NSP2, SH2D3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028121: 79%, ENSRNOG00000013737: 81%
Entrez Gene ID: 8412
Uniprot ID: O75815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKEL
Gene Sequence SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKEL
Gene ID - Mouse ENSMUSG00000028121
Gene ID - Rat ENSRNOG00000013737
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation)
Datasheet Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation)
Datasheet Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation)
Citations for Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation) – 2 Found
Zhang, Ze; Wang, Yafei; Wang, Yun; Wang, Chunli; Shuai, Yanjie; Luo, Jingtao; Liu, Ruoyan. BCAR3 promotes head and neck cancer growth and is associated with poor prognosis. Cell Death Discovery. 2021;7(1):316.  PubMed
Cross, A M; Wilson, A L; Guerrero, M S; Thomas, K S; Bachir, A I; Kubow, K E; Horwitz, A R; Bouton, A H. Breast cancer antiestrogen resistance 3-p130(Cas) interactions promote adhesion disassembly and invasion in breast cancer cells. Oncogene. 2016;35(45):5850-5859.  PubMed