Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014858-25

Protein Description: breast cancer anti-estrogen resistance 3
Gene Name: BCAR3
Alternative Gene Name: NSP2, SH2D3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028121: 79%, ENSRNOG00000013737: 81%
Entrez Gene ID: 8412
Uniprot ID: O75815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKEL
• Gene Sequence: SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKEL
• Gene ID - Mouse: ENSMUSG00000028121
• Gene ID - Rat: ENSRNOG00000013737
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BCAR3 pAb (ATL-HPA014858 w/enhanced validation) – 2 Found

Zhang, Ze; Wang, Yafei; Wang, Yun; Wang, Chunli; Shuai, Yanjie; Luo, Jingtao; Liu, Ruoyan. BCAR3 promotes head and neck cancer growth and is associated with poor prognosis. Cell Death Discovery. 2021;7(1):316. 

Cross, A M; Wilson, A L; Guerrero, M S; Thomas, K S; Bachir, A I; Kubow, K E; Horwitz, A R; Bouton, A H. Breast cancer antiestrogen resistance 3-p130(Cas) interactions promote adhesion disassembly and invasion in breast cancer cells. Oncogene. 2016;35(45):5850-5859.