Anti BCAR1 pAb (ATL-HPA042282)

Atlas Antibodies

SKU:
ATL-HPA042282-25
  • Immunofluorescence staining of mouse cerebellum shows strong positivity in Purkinje cells.
  • Western blot analysis in human spleen tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: breast cancer anti-estrogen resistance 1
Gene Name: BCAR1
Alternative Gene Name: CAS, CASS1, Crkas, P130Cas
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031955: 93%, ENSRNOG00000019253: 93%
Entrez Gene ID: 9564
Uniprot ID: P56945
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYD
Gene Sequence SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYD
Gene ID - Mouse ENSMUSG00000031955
Gene ID - Rat ENSRNOG00000019253
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BCAR1 pAb (ATL-HPA042282)
Datasheet Anti BCAR1 pAb (ATL-HPA042282) Datasheet (External Link)
Vendor Page Anti BCAR1 pAb (ATL-HPA042282) at Atlas Antibodies

Documents & Links for Anti BCAR1 pAb (ATL-HPA042282)
Datasheet Anti BCAR1 pAb (ATL-HPA042282) Datasheet (External Link)
Vendor Page Anti BCAR1 pAb (ATL-HPA042282)