Anti BCAR1 pAb (ATL-HPA042282)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042282-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BCAR1
Alternative Gene Name: CAS, CASS1, Crkas, P130Cas
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031955: 93%, ENSRNOG00000019253: 93%
Entrez Gene ID: 9564
Uniprot ID: P56945
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYD |
| Gene Sequence | SPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYD |
| Gene ID - Mouse | ENSMUSG00000031955 |
| Gene ID - Rat | ENSRNOG00000019253 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCAR1 pAb (ATL-HPA042282) | |
| Datasheet | Anti BCAR1 pAb (ATL-HPA042282) Datasheet (External Link) |
| Vendor Page | Anti BCAR1 pAb (ATL-HPA042282) at Atlas Antibodies |
| Documents & Links for Anti BCAR1 pAb (ATL-HPA042282) | |
| Datasheet | Anti BCAR1 pAb (ATL-HPA042282) Datasheet (External Link) |
| Vendor Page | Anti BCAR1 pAb (ATL-HPA042282) |