Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003906-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: B-cell receptor-associated protein 31
Gene Name: BCAP31
Alternative Gene Name: 6C6-Ag, BAP31, CDM, DXS1357E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002015: 85%, ENSRNOG00000055756: 84%
Entrez Gene ID: 10134
Uniprot ID: P51572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Gene Sequence ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Gene ID - Mouse ENSMUSG00000002015
Gene ID - Rat ENSRNOG00000055756
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)
Datasheet Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)
Datasheet Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation)
Citations for Anti BCAP31 pAb (ATL-HPA003906 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed