Anti BCAP29 pAb (ATL-HPA049694 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049694-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BCAP29
Alternative Gene Name: BAP29, DKFZp686M2086
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020650: 77%, ENSRNOG00000007884: 82%
Entrez Gene ID: 55973
Uniprot ID: Q9UHQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKK |
Gene Sequence | KLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKK |
Gene ID - Mouse | ENSMUSG00000020650 |
Gene ID - Rat | ENSRNOG00000007884 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BCAP29 pAb (ATL-HPA049694 w/enhanced validation) | |
Datasheet | Anti BCAP29 pAb (ATL-HPA049694 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BCAP29 pAb (ATL-HPA049694 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BCAP29 pAb (ATL-HPA049694 w/enhanced validation) | |
Datasheet | Anti BCAP29 pAb (ATL-HPA049694 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BCAP29 pAb (ATL-HPA049694 w/enhanced validation) |