Anti BCAP29 pAb (ATL-HPA029215 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029215-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: B-cell receptor-associated protein 29
Gene Name: BCAP29
Alternative Gene Name: BAP29, DKFZp686M2086
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020650: 76%, ENSRNOG00000007884: 76%
Entrez Gene ID: 55973
Uniprot ID: Q9UHQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAE
Gene Sequence LITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAE
Gene ID - Mouse ENSMUSG00000020650
Gene ID - Rat ENSRNOG00000007884
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BCAP29 pAb (ATL-HPA029215 w/enhanced validation)
Datasheet Anti BCAP29 pAb (ATL-HPA029215 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAP29 pAb (ATL-HPA029215 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BCAP29 pAb (ATL-HPA029215 w/enhanced validation)
Datasheet Anti BCAP29 pAb (ATL-HPA029215 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BCAP29 pAb (ATL-HPA029215 w/enhanced validation)