Anti BCAN pAb (ATL-HPA007865 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007865-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BCAN
Alternative Gene Name: BEHAB, CSPG7, MGC13038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004892: 88%, ENSRNOG00000018798: 89%
Entrez Gene ID: 63827
Uniprot ID: Q96GW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR |
| Gene Sequence | ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR |
| Gene ID - Mouse | ENSMUSG00000004892 |
| Gene ID - Rat | ENSRNOG00000018798 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCAN pAb (ATL-HPA007865 w/enhanced validation) | |
| Datasheet | Anti BCAN pAb (ATL-HPA007865 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BCAN pAb (ATL-HPA007865 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BCAN pAb (ATL-HPA007865 w/enhanced validation) | |
| Datasheet | Anti BCAN pAb (ATL-HPA007865 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BCAN pAb (ATL-HPA007865 w/enhanced validation) |
| Citations for Anti BCAN pAb (ATL-HPA007865 w/enhanced validation) – 3 Found |
| Polisetty, Ravindra Varma; Gautam, Poonam; Gupta, Manoj Kumar; Sharma, Rakesh; Gowda, Harsha; Renu, Durairaj; Shivakumar, Bhadravathi Marigowda; Lakshmikantha, Akhila; Mariswamappa, Kiran; Ankathi, Praveen; Purohit, Aniruddh K; Uppin, Megha S; Sundaram, Challa; Sirdeshmukh, Ravi. Microsomal membrane proteome of low grade diffuse astrocytomas: Differentially expressed proteins and candidate surveillance biomarkers. Scientific Reports. 2016;6( 27246909):26882. PubMed |
| Freitas, Ana; Aroso, Miguel; Barros, António; Fernández, Miriam; Conde-Sousa, Eduardo; Leite, Marina; Carvalho, Eva Daniela; Ribeiro, Cristina C; Ferreira, Rita; Pêgo, Ana Paula; Vitorino, Rui; Gomez-Lazaro, Maria. Characterization of the Striatal Extracellular Matrix in a Mouse Model of Parkinson's Disease. Antioxidants (Basel, Switzerland). 2021;10(7) PubMed |
| Monticone, Massimiliano; Daga, Antonio; Candiani, Simona; Romeo, Francesco; Mirisola, Valentina; Viaggi, Silvia; Melloni, Ilaria; Pedemonte, Simona; Zona, Gianluigi; Giaretti, Walter; Pfeffer, Ulrich; Castagnola, Patrizio. Identification of a novel set of genes reflecting different in vivo invasive patterns of human GBM cells. Bmc Cancer. 2012;12( 22901239):358. PubMed |