Anti BCAM pAb (ATL-HPA005654 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005654-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BCAM
Alternative Gene Name: CD239, LU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002980: 72%, ENSRNOG00000029399: 70%
Entrez Gene ID: 4059
Uniprot ID: P50895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQ |
| Gene Sequence | EVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQ |
| Gene ID - Mouse | ENSMUSG00000002980 |
| Gene ID - Rat | ENSRNOG00000029399 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BCAM pAb (ATL-HPA005654 w/enhanced validation) | |
| Datasheet | Anti BCAM pAb (ATL-HPA005654 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BCAM pAb (ATL-HPA005654 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BCAM pAb (ATL-HPA005654 w/enhanced validation) | |
| Datasheet | Anti BCAM pAb (ATL-HPA005654 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BCAM pAb (ATL-HPA005654 w/enhanced validation) |
| Citations for Anti BCAM pAb (ATL-HPA005654 w/enhanced validation) – 1 Found |
| Zhao, Junjie; Liang, Jiayu; Yang, Yang; Sun, Guangxi; Zhang, Xingming; Zhao, Jinge; Hu, Xu; Chen, Junru; Zhu, Sha; Ni, Yuchao; Zhang, Yaowen; Dai, Jindong; Wang, Zhipeng; Wang, Zilin; Zeng, Yuhao; Yao, Jin; Chen, Ni; Shen, Pengfei; Liu, Zhenhua; Zeng, Hao. Integrated multi-omics analyses reveal that BCAM is associated with epigenetic modification and tumor microenvironment subtypes of clear cell renal cell carcinoma. Clinical Epigenetics. 2022;14(1):99. PubMed |