Anti BCAM pAb (ATL-HPA005654 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA005654-25

• 
• 

Protein Description: basal cell adhesion molecule (Lutheran blood group)
Gene Name: BCAM
Alternative Gene Name: CD239, LU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002980: 72%, ENSRNOG00000029399: 70%
Entrez Gene ID: 4059
Uniprot ID: P50895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQ
• Gene Sequence: EVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQ
• Gene ID - Mouse: ENSMUSG00000002980
• Gene ID - Rat: ENSRNOG00000029399
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BCAM pAb (ATL-HPA005654 w/enhanced validation) – 1 Found

Zhao, Junjie; Liang, Jiayu; Yang, Yang; Sun, Guangxi; Zhang, Xingming; Zhao, Jinge; Hu, Xu; Chen, Junru; Zhu, Sha; Ni, Yuchao; Zhang, Yaowen; Dai, Jindong; Wang, Zhipeng; Wang, Zilin; Zeng, Yuhao; Yao, Jin; Chen, Ni; Shen, Pengfei; Liu, Zhenhua; Zeng, Hao. Integrated multi-omics analyses reveal that BCAM is associated with epigenetic modification and tumor microenvironment subtypes of clear cell renal cell carcinoma. Clinical Epigenetics. 2022;14(1):99.